Record Information |
---|
Version | 2.0 |
---|
Creation Date | 2009-07-06 18:11:29 UTC |
---|
Update Date | 2014-12-24 20:25:46 UTC |
---|
Accession Number | T3D2605 |
---|
Identification |
---|
Common Name | Listeriolysin O |
---|
Class | Protein |
---|
Description | Listeriolysin O (LLO) is a hemolysin produced by the bacterium Listeria monocytogenes, the pathogen responsible for causing listeriosis. The toxin may be considered a virulence factor, since it is crucial for the virulence of L. monocytogenes. (2) |
---|
Compound Type | - Amide
- Amine
- Bacterial Toxin
- Natural Compound
- Organic Compound
- Protein
|
---|
Protein Structure |  |
---|
Synonyms | Synonym | Hly | LLO | Thiol-activated cytolysin |
|
---|
Chemical Formula | Not Available |
---|
Average Molecular Mass | 58687.670 g/mol |
---|
CAS Registry Number | 112627-82-4 |
---|
Sequence | >lcl|BSEQ0008484|Listeriolysin O
MKKIMLVFITLILVSLPIAQQTEAKDASAFNKENSISSMAPPASPPASPKTPIEKKHADE
IDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKKKKSINQNNADIQVVNA
ISSLTYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTNQDNKIVVKNATKSNVNN
AVNTLVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFGTAFKAVNNSLNVNFGAIS
EGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGVNAENPPAYISSVAYGR
QVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSFKAVIYGGSAKDEVQIID
GNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAVIKNNSEYIETTSKAYTDGKIN
IDHSGGYVAQFNISWDEVNYDPEGNEIVQHKNWSENNKSKLAHFTSSIYLPGNARNINVY
AKECTGLAWEWWRTVIDDRNLPLVKNRNISIWGTTLYPKYSNKVDNPIE |
---|
Chemical Taxonomy |
---|
Description | Not Available |
---|
Kingdom | Organic Compounds |
---|
Super Class | Organic Acids |
---|
Class | Carboxylic Acids and Derivatives |
---|
Sub Class | Amino Acids, Peptides, and Analogues |
---|
Direct Parent | Peptides |
---|
Alternative Parents | Not Available |
---|
Substituents | Not Available |
---|
Molecular Framework | Not Available |
---|
External Descriptors | Not Available |
---|
Biological Properties |
---|
Status | Detected and Not Quantified |
---|
Origin | Exogenous |
---|
Cellular Locations | Not Available |
---|
Biofluid Locations | Not Available |
---|
Tissue Locations | Not Available |
---|
Pathways | Not Available |
---|
Applications | Not Available |
---|
Biological Roles | Not Available |
---|
Chemical Roles | Not Available |
---|
Physical Properties |
---|
State | Liquid |
---|
Appearance | Clear solution. |
---|
Experimental Properties | Property | Value |
---|
Melting Point | Not Available | Boiling Point | Not Available | Solubility | >10 mg/mL | LogP | Not Available |
|
---|
Predicted Properties | Not Available |
---|
Spectra |
---|
Spectra | Spectrum Type | Description | Splash Key | Deposition Date | View |
---|
|
---|
Toxicity Profile |
---|
Route of Exposure | Ingestion (4) ; inhalation (4) ; dermal (4) |
---|
Mechanism of Toxicity | Listeriolysin O is a thiol-activated cholesterol-dependent pore forming toxin protein. LLO is selectively activated within the acidic phagosomes of cells that have phagocytosed L. monocytogenes. After LLO lyses the phagosome, the bacterium escapes into the cytosol, where it can grow intracellularly, protected from extracellular immune system factors. LLO also causes dephosphorylation of histone H3 and deacetylation of histone H4 during the early phases of infection, prior to entry of L. monocytogenes into the host cell. The alterations of the histones cause the down regulation of genes encoding proteins involved in the inflammatory response. Thus, LLO may be important in subverting the host immune response to L. monocytogenes. (2) |
---|
Metabolism | Free toxin may be removed by opsonization via the reticuloendothelial system (primarily the liver and kidneys) or it may be degraded through cellular internalization via the lysosomes. Lysosomes are membrane-enclosed organelles that contain an array of digestive enzymes, including several proteases. |
---|
Toxicity Values | Not Available |
---|
Lethal Dose | 3-12 ug/kg for mice. (1) |
---|
Carcinogenicity (IARC Classification) | No indication of carcinogenicity to humans (not listed by IARC). |
---|
Uses/Sources | Listeriolysin O (LLO) is a hemolysin produced by the bacterium Listeria monocytogenes, the pathogen responsible for causing listeriosis. (2) |
---|
Minimum Risk Level | Not Available |
---|
Health Effects | Listeriolysin O (LLO) is a hemolysin produced by the bacterium Listeria monocytogenes, the pathogen responsible for causing listeriosis. The toxin may be considered a virulence factor, since it is crucial for the virulence of L. monocytogenes. Listeriosis is a bacterial disease which may effect the central nervous system, gastrointestional system, or developmental process. (2, 3) |
---|
Symptoms | Listeriosis symptoms include vomiting, nausea, stomach cramps, diarrhea, severe headache, constipation, persistent fever, stiff neck, loss of balance and convulsions. (3) |
---|
Treatment | Ampicillin generally is considered the antibiotic of choice, though gentamicin is added frequently for its synergistic effects. (3) |
---|
Normal Concentrations |
---|
| Not Available |
---|
Abnormal Concentrations |
---|
| Not Available |
---|
External Links |
---|
DrugBank ID | Not Available |
---|
HMDB ID | Not Available |
---|
PubChem Compound ID | Not Available |
---|
ChEMBL ID | Not Available |
---|
ChemSpider ID | Not Available |
---|
KEGG ID | Not Available |
---|
UniProt ID | P13128 |
---|
OMIM ID | |
---|
ChEBI ID | Not Available |
---|
BioCyc ID | Not Available |
---|
CTD ID | Not Available |
---|
Stitch ID | Listeriolysin O |
---|
PDB ID | 4CDB |
---|
ACToR ID | Not Available |
---|
Wikipedia Link | Listeriolysin_O |
---|
References |
---|
Synthesis Reference | Not Available |
---|
MSDS | Not Available |
---|
General References | - Gill DM: Bacterial toxins: a table of lethal amounts. Microbiol Rev. 1982 Mar;46(1):86-94. [6806598 ]
- Wikipedia. Listeriolysin_O. Last Updated 15 May 2009. [Link]
- Wikipedia. Listeriosis. Last Updated 7 July 2009. [Link]
- Wikipedia. Bacterial toxin. Last Updated 27 February 2009. [Link]
|
---|
Gene Regulation |
---|
Up-Regulated Genes | Not Available |
---|
Down-Regulated Genes | Not Available |
---|