NameRas-related C3 botulinum toxin substrate 3
Synonyms
  • p21-Rac3
Gene NameRAC3
OrganismHuman
Amino acid sequence
>lcl|BSEQ0017688|Ras-related C3 botulinum toxin substrate 3
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLR
DDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKPGKKCTVF
Number of residues192
Molecular Weight21378.655
Theoretical pINot Available
GO Classification
Functions
  • calcium-dependent protein binding
  • GTP binding
  • GTPase activity
Processes
  • synaptic transmission, GABAergic
  • homeostasis of number of cells within a tissue
  • small GTPase mediated signal transduction
  • positive regulation of cell adhesion mediated by integrin
  • positive regulation of substrate adhesion-dependent cell spreading
  • regulation of small GTPase mediated signal transduction
  • actin cytoskeleton organization
  • intracellular signal transduction
  • cell projection assembly
  • cerebral cortex GABAergic interneuron development
  • regulation of neuron maturation
  • neuron projection development
  • neuromuscular process controlling balance
Components
  • lamellipodium
  • cell periphery
  • plasma membrane
  • cytosol
  • extracellular exosome
  • endomembrane system
  • perinuclear region of cytoplasm
  • filamentous actin
  • neuron projection
  • growth cone
  • neuronal cell body
General FunctionGtpase activity
Specific FunctionPlasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as cell spreading and the formation of actin-based protusions including lamellipodia and membrane ruffles. Promotes cell adhesion and spreading on fibrinogen in a CIB1 and alpha-IIb/beta3 integrin-mediated manner.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP60763
UniProtKB Entry NameRAC3_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0017689|Ras-related C3 botulinum toxin substrate 3 (RAC3)
ATGCAGGCCATCAAGTGCGTGGTGGTCGGCGACGGCGCCGTGGGGAAGACATGCTTGCTG
ATCAGCTACACGACCAACGCCTTCCCCGGAGAGTACATCCCCACCGTTTTTGACAACTAC
TCTGCCAACGTGATGGTGGACGGGAAACCAGTCAACTTGGGGCTGTGGGACACAGCGGGT
CAGGAGGACTACGATCGGCTGCGGCCACTCTCCTACCCCCAAACTGACGTCTTTCTGATC
TGCTTCTCTCTGGTGAGCCCGGCCTCCTTCGAGAATGTTCGTGCCAAGTGGTACCCGGAG
GTGCGGCACCACTGCCCCCACACGCCCATCCTCCTGGTGGGCACCAAGCTGGACCTCCGC
GACGACAAGGACACCATTGAGCGGCTGCGGGACAAGAAGCTGGCACCCATCACCTACCCA
CAGGGCCTGGCCATGGCCCGGGAGATTGGCTCTGTGAAATACCTGGAGTGCTCAGCCCTG
ACCCAGCGGGGCCTGAAGACAGTGTTTGACGAGGCGATCCGCGCGGTGCTCTGCCCGCCC
CCAGTGAAGAAGCCGGGGAAGAAGTGCACCGTCTTCTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9803
Chromosome Location17
LocusNot Available
References
  1. Haataja L, Groffen J, Heisterkamp N: Characterization of RAC3, a novel member of the Rho family. J Biol Chem. 1997 Aug 15;272(33):20384-8. 9252344
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  3. Haataja L, Groffen J, Heisterkamp N: Identification of a novel Rac3-interacting protein C1D. Int J Mol Med. 1998 Apr;1(4):665-70. 9852280
  4. De Langhe S, Haataja L, Senadheera D, Groffen J, Heisterkamp N: Interaction of the small GTPase Rac3 with NRBP, a protein with a kinase-homology domain. Int J Mol Med. 2002 May;9(5):451-9. 11956649
  5. Haataja L, Kaartinen V, Groffen J, Heisterkamp N: The small GTPase Rac3 interacts with the integrin-binding protein CIB and promotes integrin alpha(IIb)beta(3)-mediated adhesion and spreading. J Biol Chem. 2002 Mar 8;277(10):8321-8. Epub 2001 Dec 27. 11756406
  6. Watabe-Uchida M, John KA, Janas JA, Newey SE, Van Aelst L: The Rac activator DOCK7 regulates neuronal polarity through local phosphorylation of stathmin/Op18. Neuron. 2006 Sep 21;51(6):727-39. 16982419
  7. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  8. Jank T, Bogdanovic X, Wirth C, Haaf E, Spoerner M, Bohmer KE, Steinemann M, Orth JH, Kalbitzer HR, Warscheid B, Hunte C, Aktories K: A bacterial toxin catalyzing tyrosine glycosylation of Rho and deamidation of Gq and Gi proteins. Nat Struct Mol Biol. 2013 Nov;20(11):1273-80. doi: 10.1038/nsmb.2688. Epub 2013 Oct 20. 24141704