NameAcetylcholine-binding protein
Synonyms
  • ACh-binding protein
Gene NameNot Available
OrganismGreat pond snail
Amino acid sequence
>lcl|BSEQ0017679|Acetylcholine-binding protein
MRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEV
NEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQ
LARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDD
SEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
Number of residues229
Molecular Weight26061.08
Theoretical pINot Available
GO Classification
Functions
  • extracellular ligand-gated ion channel activity
Components
  • integral component of membrane
  • synapse
  • extracellular region
  • cell junction
General FunctionExtracellular ligand-gated ion channel activity
Specific FunctionBinds to acetylcholine. Modulates neuronal synaptic transmission.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP58154
UniProtKB Entry NameACHP_LYMST
Cellular LocationSecreted
Gene sequenceNot Available
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDNot Available
Chromosome LocationNot Available
LocusNot Available
References
  1. Smit AB, Syed NI, Schaap D, van Minnen J, Klumperman J, Kits KS, Lodder H, van der Schors RC, van Elk R, Sorgedrager B, Brejc K, Sixma TK, Geraerts WP: A glia-derived acetylcholine-binding protein that modulates synaptic transmission. Nature. 2001 May 17;411(6835):261-8. 11357121
  2. Brejc K, van Dijk WJ, Klaassen RV, Schuurmans M, van Der Oost J, Smit AB, Sixma TK: Crystal structure of an ACh-binding protein reveals the ligand-binding domain of nicotinic receptors. Nature. 2001 May 17;411(6835):269-76. 11357122