NameNociceptin receptor
Synonyms
  • Kappa-type 3 opioid receptor
  • KOR-3
  • OOR
  • ORL1
  • Orphanin FQ receptor
Gene NameOPRL1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0004671|Nociceptin receptor
MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLA
VCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGN
ALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV
VGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIR
RLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI
LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALAC
KTSETVPRPA
Number of residues370
Molecular Weight40692.775
Theoretical pI8.43
GO Classification
Functions
  • G-protein coupled receptor activity
  • neuropeptide binding
  • nociceptin receptor activity
Processes
  • regulation of sensory perception of pain
  • negative regulation of cAMP biosynthetic process
  • negative regulation of voltage-gated calcium channel activity
  • neuropeptide signaling pathway
  • synaptic transmission
  • eating behavior
  • sensory perception
  • opioid receptor signaling pathway
  • estrous cycle
  • positive regulation of urine volume
  • positive regulation of cytosolic calcium ion concentration
  • locomotor rhythm
  • positive regulation of protein phosphorylation
  • positive regulation of gastric acid secretion
  • response to estradiol
  • sensory perception of pain
  • adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway
  • negative regulation of blood pressure
Components
  • cytoplasmic membrane-bounded vesicle
  • plasma membrane
  • cytosol
  • integral component of plasma membrane
  • neuron projection
General FunctionNociceptin receptor activity
Specific FunctionG-protein coupled opioid receptor that functions as receptor for the endogenous neuropeptide nociceptin. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling via G proteins mediates inhibition of adenylate cyclase activity and calcium channel activity. Arrestins modulate signaling via G proteins and mediate the activation of alternative signaling pathways that lead to the activation of MAP kinases. Plays a role in modulating nociception and the perception of pain. Plays a role in the regulation of locomotor activity by the neuropeptide nociceptin.
Pfam Domain Function
Transmembrane Regions49-74 88-109 125-146 166-188 212-236 265-285 301-322
GenBank Protein IDNot Available
UniProtKB IDP41146
UniProtKB Entry NameOPRX_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0016773|Nociceptin receptor (OPRL1)
ATGGAGCCCCTCTTCCCCGCGCCGTTCTGGGAGGTTATCTACGGCAGCCACCTTCAGGGC
AACCTGTCCCTCCTGAGCCCCAACCACAGTCTGCTGCCCCCGCATCTGCTGCTCAATGCC
AGCCACGGCGCCTTCCTGCCCCTCGGGCTCAAGGTCACCATCGTGGGGCTCTACCTGGCC
GTGTGTGTCGGAGGGCTCCTGGGGAACTGCCTTGTCATGTACGTCATCCTCAGGCACACC
AAAATGAAGACAGCCACCAATATTTACATCTTTAACCTGGCCCTGGCCGACACTCTGGTC
CTGCTGACGCTGCCCTTCCAGGGCACGGACATCCTCCTGGGCTTCTGGCCGTTTGGGAAT
GCGCTGTGCAAGACAGTCATTGCCATTGACTACTACAACATGTTCACCAGCACCTTCACC
CTAACTGCCATGAGTGTGGATCGCTATGTAGCCATCTGCCACCCCATCCGTGCCCTCGAC
GTCCGCACGTCCAGCAAAGCCCAGGCTGTCAATGTGGCCATCTGGGCCCTGGCCTCTGTT
GTCGGTGTTCCCGTTGCCATCATGGGCTCGGCACAGGTCGAGGATGAAGAGATCGAGTGC
CTGGTGGAGATCCCTACCCCTCAGGATTACTGGGGCCCGGTGTTTGCCATCTGCATCTTC
CTCTTCTCCTTCATCGTCCCCGTGCTCGTCATCTCTGTCTGCTACAGCCTCATGATCCGG
CGGCTCCGTGGAGTCCGCCTGCTCTCGGGCTCCCGAGAGAAGGACCGGAACCTGCGGCGC
ATCACTCGGCTGGTGCTGGTGGTAGTGGCTGTGTTCGTGGGCTGCTGGACGCCTGTCCAG
GTCTTCGTGCTGGCCCAAGGGCTGGGGGTTCAGCCGAGCAGCGAGACTGCCGTGGCCATT
CTGCGCTTCTGCACGGCCCTGGGCTACGTCAACAGCTGCCTCAACCCCATCCTCTACGCC
TTCCTGGATGAGAACTTCAAGGCCTGCTTCCGCAAGTTCTGCTGTGCATCTGCCCTGCGC
CGGGACGTGCAGGTGTCTGACCGCGTGCGCAGCATTGCCAAGGACGTGGCCCTGGCCTGC
AAGACCTCTGAGACGGTACCGCGGCCCGCATGA
GenBank Gene IDX77130
GeneCard IDNot Available
GenAtlas IDOPRL1
HGNC IDHGNC:8155
Chromosome Location20
Locus20q13.33
References
  1. Mollereau C, Parmentier M, Mailleux P, Butour JL, Moisand C, Chalon P, Caput D, Vassart G, Meunier JC: ORL1, a novel member of the opioid receptor family. Cloning, functional expression and localization. FEBS Lett. 1994 Mar 14;341(1):33-8. 8137918
  2. Serhan CN, Fierro IM, Chiang N, Pouliot M: Cutting edge: nociceptin stimulates neutrophil chemotaxis and recruitment: inhibition by aspirin-triggered-15-epi-lipoxin A4. J Immunol. 2001 Mar 15;166(6):3650-4. 11238602
  3. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. 11780052
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Wick MJ, Minnerath SR, Roy S, Ramakrishnan S, Loh HH: Expression of alternate forms of brain opioid 'orphan' receptor mRNA in activated human peripheral blood lymphocytes and lymphocytic cell lines. Brain Res Mol Brain Res. 1995 Sep;32(2):342-7. 7500847
  6. Spampinato S, Di Toro R, Alessandri M, Murari G: Agonist-induced internalization and desensitization of the human nociceptin receptor expressed in CHO cells. Cell Mol Life Sci. 2002 Dec;59(12):2172-83. 12568343
  7. Zhang NR, Planer W, Siuda ER, Zhao HC, Stickler L, Chang SD, Baird MA, Cao YQ, Bruchas MR: Serine 363 is required for nociceptin/orphanin FQ opioid receptor (NOPR) desensitization, internalization, and arrestin signaling. J Biol Chem. 2012 Dec 7;287(50):42019-30. doi: 10.1074/jbc.M112.405696. Epub 2012 Oct 19. 23086955
  8. Thompson AA, Liu W, Chun E, Katritch V, Wu H, Vardy E, Huang XP, Trapella C, Guerrini R, Calo G, Roth BL, Cherezov V, Stevens RC: Structure of the nociceptin/orphanin FQ receptor in complex with a peptide mimetic. Nature. 2012 May 16;485(7398):395-9. doi: 10.1038/nature11085. 22596163