NameUteroglobin
Synonyms
  • CC10
  • CCPBP
  • CCSP
  • Clara cell phospholipid-binding protein
  • Clara cells 10 kDa secretory protein
  • Secretoglobin family 1A member 1
  • UGB
  • UP-1
  • UP1
  • Urinary protein 1
  • Urine protein 1
Gene NameSCGB1A1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0020752|Uteroglobin
MKLAVTLTLVTLALCCSSASAEICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGA
QLKKLVDTLPQKPRESIIKLMEKIAQSSLCN
Number of residues91
Molecular Weight9993.6
Theoretical pI4.71
GO Classification
Functions
  • polychlorinated biphenyl binding
  • phospholipase A2 inhibitor activity
Processes
  • regulation of inflammatory response
  • response to xenobiotic stimulus
  • response to glucocorticoid
  • response to lipopolysaccharide
  • negative regulation of interleukin-13 production
  • negative regulation of transcription from RNA polymerase II promoter
  • negative regulation of interleukin-4 production
  • response to silicon dioxide
  • female pregnancy
  • negative regulation of T cell proliferation
  • response to cytokine
  • embryo implantation
  • signal transduction
  • regulation of mRNA stability
  • response to drug
  • response to ozone
  • response to fibroblast growth factor
  • negative regulation of interleukin-5 production
  • negative regulation of interferon-gamma production
Components
  • nuclear envelope
  • rough endoplasmic reticulum
  • extracellular space
  • extracellular exosome
  • secretory granule
General FunctionPolychlorinated biphenyl binding
Specific FunctionBinds phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB) and weakly progesterone, potent inhibitor of phospholipase A2.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID23132
UniProtKB IDP11684
UniProtKB Entry NameUTER_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0020753|Uteroglobin (SCGB1A1)
ATGAAACTCGCTGTCACCCTCACCCTGGTCACACTGGCTCTCTGCTGCAGCTCCGCTTCT
GCAGAGATCTGCCCGAGCTTTCAGCGTGTCATCGAAACCCTCCTCATGGACACACCCTCC
AGTTATGAGGCTGCCATGGAACTTTTCAGCCCTGATCAAGACATGAGGGAGGCAGGGGCT
CAGCTGAAGAAGCTGGTGGACACCCTCCCCCAAAAGCCCAGAGAAAGCATCATTAAGCTC
ATGGAAAAAATAGCCCAAAGCTCACTGTGTAATTAG
GenBank Gene IDX13197
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:12523
Chromosome Location11
Locus11q12.3-q13.1
References
  1. Singh G, Katyal SL, Brown WE, Phillips S, Kennedy AL, Anthony J, Squeglia N: Amino-acid and cDNA nucleotide sequences of human Clara cell 10 kDa protein. Biochim Biophys Acta. 1988 Sep 7;950(3):329-37. 3167058
  2. Hay JG, Danel C, Chu CS, Crystal RG: Human CC10 gene expression in airway epithelium and subchromosomal locus suggest linkage to airway disease. Am J Physiol. 1995 Apr;268(4 Pt 1):L565-75. 7733299
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Wolf M, Klug J, Hackenberg R, Gessler M, Grzeschik KH, Beato M, Suske G: Human CC10, the homologue of rabbit uteroglobin: genomic cloning, chromosomal localization and expression in endometrial cell lines. Hum Mol Genet. 1992 Sep;1(6):371-8. 1284526
  6. Okutani R, Itoh Y, Hirata H, Kasahara T, Mukaida N, Kawai T: Simple and high-yield purification of urine protein 1 using immunoaffinity chromatography: evidence for the identity of urine protein 1 and human Clara cell 10-kilodalton protein. J Chromatogr. 1992 May 20;577(1):25-35. 1400743
  7. Bernard A, Roels H, Lauwerys R, Witters R, Gielens C, Soumillion A, Van Damme J, De Ley M: Human urinary protein 1: evidence for identity with the Clara cell protein and occurrence in respiratory tract and urogenital secretions. Clin Chim Acta. 1992 May 15;207(3):239-49. 1395029
  8. Ghafouri B, Stahlbom B, Tagesson C, Lindahl M: Newly identified proteins in human nasal lavage fluid from non-smokers and smokers using two-dimensional gel electrophoresis and peptide mass fingerprinting. Proteomics. 2002 Jan;2(1):112-20. 11788998
  9. Umland TC, Swaminathan S, Singh G, Warty V, Furey W, Pletcher J, Sax M: Structure of a human Clara cell phospholipid-binding protein-ligand complex at 1.9 A resolution. Nat Struct Biol. 1994 Aug;1(8):538-45. 7664082