NameMacrophage colony-stimulating factor 1
Synonyms
  • CSF-1
  • Lanimostim
Gene NameCSF1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037132|Macrophage colony-stimulating factor 1
MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME
TSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLK
SCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSS
QDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQP
LHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQPRPSVGAFNPGMEDILDSAMG
TNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPLPASAKGQQPA
DVTGTALPRVGPVRPTGQDWNHTPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPSTLS
AQPQLSRSHSSGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTG
HERQSEGSFSPQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEG
SPLTQDDRQVELPV
Number of residues554
Molecular Weight60178.885
Theoretical pI4.94
GO Classification
Functions
  • protein homodimerization activity
  • macrophage colony-stimulating factor receptor binding
  • growth factor activity
  • cytokine activity
Processes
  • positive regulation of microglial cell migration
  • macrophage colony-stimulating factor signaling pathway
  • osteoclast differentiation
  • positive regulation of monocyte differentiation
  • positive regulation of osteoclast differentiation
  • positive regulation of mononuclear cell proliferation
  • positive regulation of cell-matrix adhesion
  • positive regulation of odontogenesis of dentin-containing tooth
  • positive regulation of protein kinase activity
  • cell differentiation
  • regulation of macrophage derived foam cell differentiation
  • homeostasis of number of cells within a tissue
  • innate immune response
  • positive regulation of macrophage chemotaxis
  • positive regulation of cell migration
  • positive regulation of macrophage differentiation
  • positive regulation of cell proliferation
  • transmembrane receptor protein tyrosine kinase signaling pathway
  • positive regulation of cellular protein metabolic process
  • branching involved in mammary gland duct morphogenesis
  • positive regulation of macrophage derived foam cell differentiation
  • developmental process involved in reproduction
  • positive regulation of gene expression
  • mammary duct terminal end bud growth
  • macrophage differentiation
  • mammary gland fat development
  • positive regulation of multicellular organism growth
  • regulation of ossification
  • monocyte activation
  • positive regulation of Ras protein signal transduction
  • inflammatory response
  • osteoclast proliferation
  • cell proliferation
  • positive regulation of macrophage colony-stimulating factor signaling pathway
  • hemopoiesis
Components
  • integral component of membrane
  • extracellular exosome
  • perinuclear region of cytoplasm
  • membrane
  • plasma membrane
  • extracellular space
  • CSF1-CSF1R complex
General FunctionProtein homodimerization activity
Specific FunctionCytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance.
Pfam Domain Function
Transmembrane Regions497-517
GenBank Protein ID181144
UniProtKB IDP09603
UniProtKB Entry NameCSF1_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0010809|Macrophage colony-stimulating factor 1 (CSF1)
ATGACCGCGCCGGGCGCCGCCGGGCGCTGCCCTCCCACGACATGGCTGGGCTCCCTGCTG
TTGTTGGTCTGTCTCCTGGCGAGCAGGAGTATCACCGAGGAGGTGTCGGAGTACTGTAGC
CACATGATTGGGAGTGGACACCTGCAGTCTCTGCAGCGGCTGATTGACAGTCAGATGGAG
ACCTCGTGCCAAATTACATTTGAGTTTGTAGACCAGGAACAGTTGAAAGATCCAGTGTGC
TACCTTAAGAAGGCATTTCTCCTGGTACAAGACATAATGGAGGACACCATGCGCTTCAGA
GATAACACCCCCAATGCCATCGCCATTGTGCAGCTGCAGGAACTCTCTTTGAGGCTGAAG
AGCTGCTTCACCAAGGATTATGAAGAGCATGACAAGGCCTGCGTCCGAACTTTCTATGAG
ACACCTCTCCAGTTGCTGGAGAAGGTCAAGAATGTCTTTAATGAAACAAAGAATCTCCTT
GACAAGGACTGGAATATTTTCAGCAAGAACTGCAACAACAGCTTTGCTGAATGCTCCAGC
CAAGATGTGGTGACCAAGCCTGATTGCAACTGCCTGTACCCCAAAGCCATCCCTAGCAGT
GACCCGGCCTCTGTCTCCCCTCATCAGCCCCTCGCCCCCTCCATGGCCCCTGTGGCTGGC
TTGACCTGGGAGGACTCTGAGGGAACTGAGGGCAGCTCCCTCTTGCCTGGTGAGCAGCCC
CTGCACACAGTGGATCCAGGCAGTGCCAAGCAGCGGCCACCCAGGAGCACCTGCCAGAGC
TTTGAGCCGCCAGAGACCCCAGTTGTCAAGGACAGCACCATCGGTGGCTCACCACAGCCT
CGCCCCTCTGTCGGGGCCTTCAACCCCGGGATGGAGGATATTCTTGACTCTGCAATGGGC
ACTAATTGGGTCCCAGAAGAAGCCTCTGGAGAGGCCAGTGAGATTCCCGTACCCCAAGGG
ACAGAGCTTTCCCCCTCCAGGCCAGGAGGGGGCAGCATGCAGACAGAGCCCGCCAGACCC
AGCAACTTCCTCTCAGCATCTTCTCCACTCCCTGCATCAGCAAAGGGCCAACAGCCGGCA
GATGTAACTGGTACCGCCTTGCCCAGGGTGGGCCCCGTGAGGCCCACTGGCCAGGACTGG
AATCACACCCCCCAGAAGACAGACCATCCATCTGCCCTGCTCAGAGACCCCCCGGAGCCA
GGCTCTCCCAGGATCTCATCACTGCGCCCCCAGGGCCTCAGCAACCCCTCCACCCTCTCT
GCTCAGCCACAGCTTTCCAGAAGCCACTCCTCGGGCAGCGTGCTGCCCCTTGGGGAGCTG
GAGGGCAGGAGGAGCACCAGGGATCGGAGGAGCCCCGCAGAGCCAGAAGGAGGACCAGCA
AGTGAAGGGGCAGCCAGGCCCCTGCCCCGTTTTAACTCCGTTCCTTTGACTGACACAGGC
CATGAGAGGCAGTCCGAGGGATCCTCCAGCCCGCAGCTCCAGGAGTCTGTCTTCCACCTG
CTGGTGCCCAGTGTCATCCTGGTCTTGCTGGCCGTCGGAGGCCTCTTGTTCTACAGGTGG
AGGCGGCGGAGCCATCAAGAGCCTCAGAGAGCGGATTCTCCCTTGGAGCAACCAGAGGGC
AGCCCCCTGACTCAGGATGACAGACAGGTGGAACTGCCAGTGTAG
GenBank Gene IDM11296
GeneCard IDNot Available
GenAtlas IDCSF1
HGNC IDHGNC:2432
Chromosome Location1
Locus1p21-p13
References
  1. Kawasaki ES, Ladner MB, Wang AM, Van Arsdell J, Warren MK, Coyne MY, Schweickart VL, Lee MT, Wilson KJ, Boosman A, et al.: Molecular cloning of a complementary DNA encoding human macrophage-specific colony-stimulating factor (CSF-1). Science. 1985 Oct 18;230(4723):291-6. 2996129
  2. Wong GG, Temple PA, Leary AC, Witek-Giannotti JS, Yang YC, Ciarletta AB, Chung M, Murtha P, Kriz R, Kaufman RJ, et al.: Human CSF-1: molecular cloning and expression of 4-kb cDNA encoding the human urinary protein. Science. 1987 Mar 20;235(4795):1504-8. 3493529
  3. Cerretti DP, Wignall J, Anderson D, Tushinski RJ, Gallis BM, Stya M, Gillis S, Urdal DL, Cosman D: Human macrophage-colony stimulating factor: alternative RNA and protein processing from a single gene. Mol Immunol. 1988 Aug;25(8):761-70. 2460758
  4. Takahashi M, Hirato T, Takano M, Nishida T, Nagamura K, Kamogashira T, Nakai S, Hirai Y: Amino-terminal region of human macrophage colony-stimulating factor (M-CSF) is sufficient for its in vitro biological activity: molecular cloning and expression of carboxyl-terminal deletion mutants of human M-CSF. Biochem Biophys Res Commun. 1989 Jun 15;161(2):892-901. 2660794
  5. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  6. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. 16710414
  7. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  8. Ladner MB, Martin GA, Noble JA, Nikoloff DM, Tal R, Kawasaki ES, White TJ: Human CSF-1: gene structure and alternative splicing of mRNA precursors. EMBO J. 1987 Sep;6(9):2693-8. 3500041
  9. Pampfer S, Tabibzadeh S, Chuan FC, Pollard JW: Expression of colony-stimulating factor-1 (CSF-1) messenger RNA in human endometrial glands during the menstrual cycle: molecular cloning of a novel transcript that predicts a cell surface form of CSF-1. Mol Endocrinol. 1991 Dec;5(12):1931-8. 1791839
  10. Yamanishi K, Yasuda S, Masui Y, Nishida T, Shindo Y, Takano M, Ohmoto Y, Takahashi M, Adachi M: The structure of recombinant human carboxy-terminal-truncated macrophage colony-stimulating factor derived from mammalian cells. J Biochem. 1993 Aug;114(2):255-62. 8262907
  11. Sakai N, Umeda T, Suzuki H, Ishimatsu Y, Shikita M: Macrophage colony-stimulating factor purified from normal human urine. Amino-terminal sequence and amino acid composition. FEBS Lett. 1987 Oct 5;222(2):341-4. 3498652
  12. Takahashi M, Hong YM, Yasuda S, Takano M, Kawai K, Nakai S, Hirai Y: Macrophage colony-stimulating factor is produced by human T lymphoblastoid cell line, CEM-ON: identification by amino-terminal amino acid sequence analysis. Biochem Biophys Res Commun. 1988 May 16;152(3):1401-9. 3259875
  13. Rettenmier CW, Roussel MF, Ashmun RA, Ralph P, Price K, Sherr CJ: Synthesis of membrane-bound colony-stimulating factor 1 (CSF-1) and downmodulation of CSF-1 receptors in NIH 3T3 cells transformed by cotransfection of the human CSF-1 and c-fms (CSF-1 receptor) genes. Mol Cell Biol. 1987 Jul;7(7):2378-87. 3039346
  14. Rettenmier CW, Roussel MF: Differential processing of colony-stimulating factor 1 precursors encoded by two human cDNAs. Mol Cell Biol. 1988 Nov;8(11):5026-34. 3264877
  15. Suzu S, Ohtsuki T, Yanai N, Takatsu Z, Kawashima T, Takaku F, Nagata N, Motoyoshi K: Identification of a high molecular weight macrophage colony-stimulating factor as a glycosaminoglycan-containing species. J Biol Chem. 1992 Mar 5;267(7):4345-8. 1531650
  16. Glocker MO, Arbogast B, Schreurs J, Deinzer ML: Assignment of the inter- and intramolecular disulfide linkages in recombinant human macrophage colony stimulating factor using fast atom bombardment mass spectrometry. Biochemistry. 1993 Jan 19;32(2):482-8. 8422357
  17. Pixley FJ, Stanley ER: CSF-1 regulation of the wandering macrophage: complexity in action. Trends Cell Biol. 2004 Nov;14(11):628-38. 15519852
  18. Chitu V, Stanley ER: Colony-stimulating factor-1 in immunity and inflammation. Curr Opin Immunol. 2006 Feb;18(1):39-48. Epub 2005 Dec 6. 16337366
  19. Douglass TG, Driggers L, Zhang JG, Hoa N, Delgado C, Williams CC, Dan Q, Sanchez R, Jeffes EW, Wepsic HT, Myers MP, Koths K, Jadus MR: Macrophage colony stimulating factor: not just for macrophages anymore! A gateway into complex biologies. Int Immunopharmacol. 2008 Oct;8(10):1354-76. doi: 10.1016/j.intimp.2008.04.016. Epub 2008 Jun 2. 18687298
  20. Patsialou A, Wyckoff J, Wang Y, Goswami S, Stanley ER, Condeelis JS: Invasion of human breast cancer cells in vivo requires both paracrine and autocrine loops involving the colony-stimulating factor-1 receptor. Cancer Res. 2009 Dec 15;69(24):9498-506. doi: 10.1158/0008-5472.CAN-09-1868. Epub . 19934330
  21. Eda H, Zhang J, Keith RH, Michener M, Beidler DR, Monahan JB: Macrophage-colony stimulating factor and interleukin-34 induce chemokines in human whole blood. Cytokine. 2010 Dec;52(3):215-20. doi: 10.1016/j.cyto.2010.08.005. Epub 2010 Sep 9. 20829061
  22. Wei S, Nandi S, Chitu V, Yeung YG, Yu W, Huang M, Williams LT, Lin H, Stanley ER: Functional overlap but differential expression of CSF-1 and IL-34 in their CSF-1 receptor-mediated regulation of myeloid cells. J Leukoc Biol. 2010 Sep;88(3):495-505. doi: 10.1189/jlb.1209822. Epub 2010 May 26. 20504948
  23. Halim A, Nilsson J, Ruetschi U, Hesse C, Larson G: Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD. Mol Cell Proteomics. 2012 Apr;11(4):M111.013649. doi: 10.1074/mcp.M111.013649. Epub 2011 Dec 14. 22171320
  24. Halim A, Ruetschi U, Larson G, Nilsson J: LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins. J Proteome Res. 2013 Feb 1;12(2):573-84. doi: 10.1021/pr300963h. Epub 2013 Jan 11. 23234360
  25. Tagliabracci VS, Wiley SE, Guo X, Kinch LN, Durrant E, Wen J, Xiao J, Cui J, Nguyen KB, Engel JL, Coon JJ, Grishin N, Pinna LA, Pagliarini DJ, Dixon JE: A Single Kinase Generates the Majority of the Secreted Phosphoproteome. Cell. 2015 Jun 18;161(7):1619-32. doi: 10.1016/j.cell.2015.05.028. 26091039
  26. Pandit J, Bohm A, Jancarik J, Halenbeck R, Koths K, Kim SH: Three-dimensional structure of dimeric human recombinant macrophage colony-stimulating factor. Science. 1992 Nov 20;258(5086):1358-62. 1455231